PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G346300.5.p
Common NameGLYMA_13G346300, LOC100812210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 939aa    MW: 103102 Da    PI: 6.1555
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G346300.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.51.6e-29554604252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Glyma.13G346300.5.p 554 EKNVSLSVLQQYFSGSLKDAAKNIGVCPTTLKRICRQHGIPRWPSRKINKV 604
                          89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166538624IPR003035RWP-RK domain
PfamPF020424.9E-26556604IPR003035RWP-RK domain
SuperFamilySSF542773.04E-21834923No hitNo description
SMARTSM006665.5E-19838920IPR000270PB1 domain
PROSITE profilePS5174518.289838920IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.7E-22839920No hitNo description
PfamPF005641.2E-14841919IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 939 aa     Download sequence    Send to blast
MEYPFSPKDR VIGDWQSSGA QLEGSASLDG RMINSISEDM PNSFSELMNF DTYAGLCYSP  60
SITDQILANE LPSFAPLSYP LPDGFNPVQL NSGQCCMSGV GRNNNDTENS SLYGNYMMSR  120
PPGLSLDERM LRALSFFKES AGGGILAQVW VPIKDGDQFI LSTSEQPYLL DQMLAGYREV  180
SRTFTFSAEG KSGCSLGLPG RVFTSKVPEW TSNVGYYSMS EYLRFEHAIN HKVCGSIAFP  240
IFDLHSELPC CAVLELVTTN EKPDFDRELE IVCRALQLVN LRTAKPLRCL PQCLSNNKKA  300
TLTEIVDVLR SVCHAHRLPL GLTWIPCCFT ECSRGEASSI RIEGGHSTSR GKNILCLEES  360
ACYITDRAMG GFVRACMEHR LEEGKGIAGK ALQSNHPFFY PDVKTYDISE YPLVHHARKY  420
NLNAAVAIRL RSTYTNDDDY ILEFFLPVNM KGSSEQQLLL DNLSGTMQRI CSSLRTVSET  480
ELSGMESLAV GLGKKNAPSF FPLSSRNSEI PLINGDCDSV QKATNLRDNE IESSPNQERN  540
GSKRQVQKNR STSEKNVSLS VLQQYFSGSL KDAAKNIGVC PTTLKRICRQ HGIPRWPSRK  600
INKVNRSLKK IQTVLDSVQG VEGGLKVLDS VQGVEGVLKF DPSMGAFVAG GSIIQEIDAH  660
KSTIKDPVPV AQDAFSVRPA PCSEGENFSI KLEGKLKKTN VSSVNYSEDS KSMAINDGSC  720
QTASLCTKVQ DCPEQACLGS VLAKEHDKRI LNKGGLSVEK FKRNIVGQSS KTLIGDEMDI  780
GVDGDDGVVE RNHPTSSSLI DSSNGSGSMM HSSSSGSQSF KNQDQSKVKS TIVDSRSKLI  840
VKATYREDTI RFKFDPCAGC FSLYEEVAAR FKLQNGLFQL KYLDDEEEWV MLVNNADLQE  900
CIEILDDIGT RSVRFLVRDM PSVLGSSGSS NSYLGGSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0283180.0EU028318.1 Glycine max clone BAC gmw1-45b2 genomic sequence.
GenBankEU0283190.0EU028319.1 Glycine max clone BAC gmw1-91g6 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014621588.10.0PREDICTED: protein NLP9 isoform X2
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLK7M3K90.0K7M3K9_SOYBN; Uncharacterized protein
STRINGGLYMA13G42160.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein